PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013896359.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
Family MYB
Protein Properties Length: 654aa    MW: 64921 Da    PI: 4.4983
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013896359.1genomeBUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.42.8e-121265147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.......TTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.......kgRtlkqcksrwqky 47
                     +g W +eEde l +av + G ++W ++ar+++        gRt+kqc+ r+  +
   XP_013896359.1 12 KGTWKPEEDEALRRAVDRAGDKNWMAVAREVNmalayegGGRTAKQCRGRYMHH 65
                     799***********************************************9877 PP

2Myb_DNA-binding52.79.9e-1772114145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg+WT eE+e lv+ +++lG+  W++Ia++++ gRt+ ++k++w+
   XP_013896359.1  72 RGPWTWEEEETLVRSHQLLGNS-WSKIAKYLP-GRTETDIKNHWN 114
                      89******************99.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.674766IPR017930Myb domain
SuperFamilySSF466896.74E-2811113IPR009057Homeodomain-like
SMARTSM007179.2E-101168IPR001005SANT/Myb domain
PfamPF002493.7E-111265IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-191373IPR009057Homeodomain-like
CDDcd001673.65E-81466No hitNo description
PROSITE profilePS5129425.82467121IPR017930Myb domain
SMARTSM007179.2E-1771119IPR001005SANT/Myb domain
PfamPF002495.6E-1572114IPR001005SANT/Myb domain
CDDcd001671.06E-1274117No hitNo description
Gene3DG3DSA:1.10.10.604.3E-2274123IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 654 aa     Download sequence    Send to blast
MRHHVHLVGE IKGTWKPEED EALRRAVDRA GDKNWMAVAR EVNMALAYEG GGRTAKQCRG  60
RYMHHLKPGL KRGPWTWEEE ETLVRSHQLL GNSWSKIAKY LPGRTETDIK NHWNCTLRKK  120
MPWDDVHRSP LQRYQLAHGL STGRAAMARV PGGPSPPRLG GHGGYDDGDE GEDDVAAAGM  180
GDGSGGGGVP FAAYPPDVLV AAQDAAAELL ESDAGRTMTP DVAAAVLASR GHPFDVAFTA  240
VLLQLQHSVE AAAAASLDAA AEVQADGGPD GEEGGAGAGG GAEVGADDDG RAAAGHQLAL  300
KADSDAGHAL EPGGDGHGGS QGDGGGGGSL AAAVAALAGL AAHRDPAAPS PPPPLPLAGP  360
SVLAAPLAPV PSSGSGGLPL LLTAAPAPPA ALPLVAALAS EGSPRDVLRR VAAVLTALAD  420
GAEARANGGT GVAVDAADAD VALEYLRERL GLGQAGSGCD AEMQPGLPSV TQAATPSLPP  480
PALPLPRALQ RQKRAADEGV PAPAAKRAAL GGAGAANGMF VAEAPTVPRA AMAQLVAPPL  540
LPQLVPLGSF TASASGALPL PVVAPRPEPA AAAADAAAAA AAAVSGAEIR AAMAAAMAGG  600
DSDEEDEEEG DDEEEDEQEG DGGAECAGDS KGGVDAAAGS SGASSSGAAP HSEG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-29111213105MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-281112157159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-281112157159MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-29111213105C-Myb DNA-Binding Domain
1msf_C2e-29111213105C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013896359.10.0Myb-related protein Zm1
TrEMBLA0A0D2M0Z50.0A0A0D2M0Z5_9CHLO; Myb-related protein Zm1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1516114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40360.17e-28myb domain protein 115
Publications ? help Back to Top
  1. Bogen C, et al.
    Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production.
    BMC Genomics, 2013. 14: p. 926
    [PMID:24373495]